|
|
|
|
|
|
|
|
|
|
|
| Refolding Record [Created: 2008-12-22 Updated: 2008-12-22 ] |
|
|
|
|
PROTEIN |
| Protein Name |
Interferon Beta |
| Abbreviated Name |
IFNb |
| SCOP Family |
Interferons/interleukin-10 (IL-10) |
| Structure Notes |
n/a |
| Organism |
Escherichia coli |
| UniProt Accession |
|
| SCOP Unique ID |
n/a |
| Structure Solved |
|
| Class |
Alpha |
| Molecularity |
Monomer |
|
CONSTRUCT |
| Full Length |
y |
| Domain |
n/a |
| Chimera |
n/a |
| Variants |
n/a |
| Chain Length |
169 |
| Molecular Weight |
20011 |
| pI |
9.01804 |
| Disulphides |
1 |
Pfam Domain(s) and
Number of Occurrences |
Interferon(1) |
| Domain Graphics |
 |
| Full Sequence |
MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF
QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT
VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI
LRNFYFINRLTGYLRN
BLAST against Refold database | BLAST against NCBI NR database
|
| Notes |
n/a |
|
EXPRESSION |
| Report |
Unpublished ( 0) J Virol Methods, 0, 0 |
| Project Aim |
Folding, Antigenic Determinant Identification, Cloning and expression, Analysis, Analysis, Analysis |
| Fusion |
N-terminal thioredoxin + hexahistidine tag |
Protein Expression and
Production |
Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host |
E.coli |
| Expression Strain |
bl21 de3 |
| Expression Temperature |
37 |
| Expression Time |
4hrs |
| Expression Vector |
pet 44 |
| Expression Protocol |
Luria Broth in Erlenmeyer flask |
| Method of Induction |
IPTG |
| Cell Density (at induction) |
n/a |
| Cell Disruption Method |
Cell disrupter |
| Lytic Agent |
Lysozyme |
| Pre-refolding Purification |
None |
| Solubility |
insoluble |
|
REFOLDING |
| Refolding Method |
Dilution/Column Refolding Combination |
| Wash Buffer |
Urea 6m pH 8 |
| Solubilization Buffer |
Urea 6m pH 12 |
| Refolding Buffer |
Dont know |
| Pre-refolding Purification |
None |
| Tag Cleaved |
no |
| Refolding pH |
8 |
| Refolding Temperature |
37 |
| Protein Concentration |
n/a |
| Refolding Time |
n/a |
| Redox Agent |
Beta-mercaptoethanol |
| Redox Agent Concentration |
n/a |
| Refolding Protocol |
n/a |
| Assay |
Biochemical analyses, Biological assay, Activity assay, Bradford assay |
| Chaperones |
None |
| Additives |
None |
| Additives Concentration |
n/a |
| Refolding Yield |
n/a |
| Purity |
n/a |
| Notes |
|
|
|
|
|
|
|
|
|
